Anti ZNF256 pAb (ATL-HPA055390)

Atlas Antibodies

SKU:
ATL-HPA055390-25
  • Immunohistochemical staining of human stomach, lower shows strong cytoplasmic and membranous positivity in glandular cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 256
Gene Name: ZNF256
Alternative Gene Name: BMZF-3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038805: 29%, ENSRNOG00000015271: 39%
Entrez Gene ID: 10172
Uniprot ID: Q9Y2P7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NLTLTTSLGGSGAGDEEAPYQQSTSPQRVSQVRIPKALPSPQKTNPCEIC
Gene Sequence NLTLTTSLGGSGAGDEEAPYQQSTSPQRVSQVRIPKALPSPQKTNPCEIC
Gene ID - Mouse ENSMUSG00000038805
Gene ID - Rat ENSRNOG00000015271
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ZNF256 pAb (ATL-HPA055390)
Datasheet Anti ZNF256 pAb (ATL-HPA055390) Datasheet (External Link)
Vendor Page Anti ZNF256 pAb (ATL-HPA055390) at Atlas Antibodies

Documents & Links for Anti ZNF256 pAb (ATL-HPA055390)
Datasheet Anti ZNF256 pAb (ATL-HPA055390) Datasheet (External Link)
Vendor Page Anti ZNF256 pAb (ATL-HPA055390)