Anti ZNF235 pAb (ATL-HPA045582)

Atlas Antibodies

SKU: ATL-HPA045582-25

• 
• 

Protein Description: zinc finger protein 235
Gene Name: ZNF235
Alternative Gene Name: ANF270, HZF6, ZFP93, ZNF270
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074283: 47%, ENSRNOG00000024376: 39%
Entrez Gene ID: 9310
Uniprot ID: Q14590
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ASVDDNCLVNHIGDHSSIIENQEFPTGKVPNSWSKIYLNETQNYQRSCKQTQMKNKLCIFAPYVDIFSCISHHH
• Gene Sequence: ASVDDNCLVNHIGDHSSIIENQEFPTGKVPNSWSKIYLNETQNYQRSCKQTQMKNKLCIFAPYVDIFSCISHHH
• Gene ID - Mouse: ENSMUSG00000074283
• Gene ID - Rat: ENSRNOG00000024376
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.