Anti ZNF22 pAb (ATL-HPA054893)

Atlas Antibodies

SKU: ATL-HPA054893-25

• 

Protein Description: zinc finger protein 22
Gene Name: ZNF22
Alternative Gene Name: HKR-T1, KOX15, Zfp422, ZNF422
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059878: 76%, ENSRNOG00000013379: 74%
Entrez Gene ID: 7570
Uniprot ID: P17026
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MRLAKPKAGISRSSSQGKAYENKRKTGRQRQKWGMTIRFDSSFSRLRRSLDDKP
• Gene Sequence: MRLAKPKAGISRSSSQGKAYENKRKTGRQRQKWGMTIRFDSSFSRLRRSLDDKP
• Gene ID - Mouse: ENSMUSG00000059878
• Gene ID - Rat: ENSRNOG00000013379
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.