Anti ZNF219 pAb (ATL-HPA056168)

Atlas Antibodies

SKU:
ATL-HPA056168-25
  • Immunohistochemical staining of human skin shows cytoplasmic positivity in epidermal cells.
  • Immunofluorescent staining of human cell line HeLa shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 219
Gene Name: ZNF219
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049295: 88%, ENSRNOG00000011544: 89%
Entrez Gene ID: 51222
Uniprot ID: Q9P2Y4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EAEEETWARGRSLGSLASLHPRPGEGPGHSASAAGAQARSTATQEENGLLVGGTRPEGGRGATGKDCPFCGKSFRSAHHLK
Gene Sequence EAEEETWARGRSLGSLASLHPRPGEGPGHSASAAGAQARSTATQEENGLLVGGTRPEGGRGATGKDCPFCGKSFRSAHHLK
Gene ID - Mouse ENSMUSG00000049295
Gene ID - Rat ENSRNOG00000011544
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ZNF219 pAb (ATL-HPA056168)
Datasheet Anti ZNF219 pAb (ATL-HPA056168) Datasheet (External Link)
Vendor Page Anti ZNF219 pAb (ATL-HPA056168) at Atlas Antibodies

Documents & Links for Anti ZNF219 pAb (ATL-HPA056168)
Datasheet Anti ZNF219 pAb (ATL-HPA056168) Datasheet (External Link)
Vendor Page Anti ZNF219 pAb (ATL-HPA056168)