Anti ZNF143 pAb (ATL-HPA074818)

Atlas Antibodies

SKU: ATL-HPA074818-25

• 

Protein Description: zinc finger protein 143
Gene Name: ZNF143
Alternative Gene Name: pHZ-1, SBF, STAF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061079: 94%, ENSRNOG00000010087: 93%
Entrez Gene ID: 7702
Uniprot ID: P52747
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AVQVPQSDTILAIQADGTVAGLHTGDATIDPDTISALEQYAAKVSIDGSESVAGTGMIGENEQEKKMQIVLQGHATRVTAKSQQSG
• Gene Sequence: AVQVPQSDTILAIQADGTVAGLHTGDATIDPDTISALEQYAAKVSIDGSESVAGTGMIGENEQEKKMQIVLQGHATRVTAKSQQSG
• Gene ID - Mouse: ENSMUSG00000061079
• Gene ID - Rat: ENSRNOG00000010087
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.