Anti ZNF142 pAb (ATL-HPA049594)

Atlas Antibodies

SKU: ATL-HPA049594-25

• 
• 

Protein Description: zinc finger protein 142
Gene Name: ZNF142
Alternative Gene Name: KIAA0236, pHZ-49
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026135: 94%, ENSRNOG00000022414: 94%
Entrez Gene ID: 7701
Uniprot ID: P52746
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RHQGKSLMCEVCAFACKRKYELQKHMASQHHPGTPSPLYPCHYCSYQSRHKQAVLSHENCKHTRLREFHCALCDYRTFSNTTLL
• Gene Sequence: RHQGKSLMCEVCAFACKRKYELQKHMASQHHPGTPSPLYPCHYCSYQSRHKQAVLSHENCKHTRLREFHCALCDYRTFSNTTLL
• Gene ID - Mouse: ENSMUSG00000026135
• Gene ID - Rat: ENSRNOG00000022414
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.