Anti ZNF140 pAb (ATL-HPA048332)

Atlas Antibodies

Catalog No.:
ATL-HPA048332-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 140
Gene Name: ZNF140
Alternative Gene Name: pHZ-39
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046185: 28%, ENSRNOG00000002578: 26%
Entrez Gene ID: 7699
Uniprot ID: P52738
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GKREVKRDLFSVSESSGEIKDFSPKNVIYDDSSQYLIMERILSQGPVYSSFKGGWKCKDHTEMLQENQGCIRKVTVSHQEAL
Gene Sequence GKREVKRDLFSVSESSGEIKDFSPKNVIYDDSSQYLIMERILSQGPVYSSFKGGWKCKDHTEMLQENQGCIRKVTVSHQEAL
Gene ID - Mouse ENSMUSG00000046185
Gene ID - Rat ENSRNOG00000002578
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF140 pAb (ATL-HPA048332)
Datasheet Anti ZNF140 pAb (ATL-HPA048332) Datasheet (External Link)
Vendor Page Anti ZNF140 pAb (ATL-HPA048332) at Atlas Antibodies

Documents & Links for Anti ZNF140 pAb (ATL-HPA048332)
Datasheet Anti ZNF140 pAb (ATL-HPA048332) Datasheet (External Link)
Vendor Page Anti ZNF140 pAb (ATL-HPA048332)