Anti ZMYM4 pAb (ATL-HPA051301)

Atlas Antibodies

SKU:
ATL-HPA051301-25
  • Immunohistochemical staining of human testis shows nuclear and cytoplasmic positivity in cells in seminiferous ducts.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: zinc finger, MYM-type 4
Gene Name: ZMYM4
Alternative Gene Name: KIAA0425, MYM, ZNF198L3, ZNF262
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042446: 94%, ENSRNOG00000012397: 95%
Entrez Gene ID: 9202
Uniprot ID: Q5VZL5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen WEEELNHYALKSNAVQEADSELKQFSKGETEQDLEADFPSDSFDPLNKGQGIQARSRTRRRHRDGFPQPRRRGRKKSIVAVEPRSLI
Gene Sequence WEEELNHYALKSNAVQEADSELKQFSKGETEQDLEADFPSDSFDPLNKGQGIQARSRTRRRHRDGFPQPRRRGRKKSIVAVEPRSLI
Gene ID - Mouse ENSMUSG00000042446
Gene ID - Rat ENSRNOG00000012397
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ZMYM4 pAb (ATL-HPA051301)
Datasheet Anti ZMYM4 pAb (ATL-HPA051301) Datasheet (External Link)
Vendor Page Anti ZMYM4 pAb (ATL-HPA051301) at Atlas Antibodies

Documents & Links for Anti ZMYM4 pAb (ATL-HPA051301)
Datasheet Anti ZMYM4 pAb (ATL-HPA051301) Datasheet (External Link)
Vendor Page Anti ZMYM4 pAb (ATL-HPA051301)