Anti ZMAT4 pAb (ATL-HPA069813 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA069813-25

• 

Protein Description: zinc finger, matrin-type 4
Gene Name: ZMAT4
Alternative Gene Name: FLJ13842
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037492: 91%, ENSRNOG00000042690: 84%
Entrez Gene ID: 79698
Uniprot ID: Q9H898
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QHYDGKKHKKNAARVALLEQLGTTLDMGELRGLRRNYRCTICSVSLNSIEQYH
• Gene Sequence: QHYDGKKHKKNAARVALLEQLGTTLDMGELRGLRRNYRCTICSVSLNSIEQYH
• Gene ID - Mouse: ENSMUSG00000037492
• Gene ID - Rat: ENSRNOG00000042690
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.