Anti ZMAT3 pAb (ATL-HPA054356)

Atlas Antibodies

SKU: ATL-HPA054356-25

• 

Protein Description: zinc finger, matrin-type 3
Gene Name: ZMAT3
Alternative Gene Name: FLJ12296, MGC10613, PAG608, WIG-1, WIG1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027663: 96%, ENSRNOG00000010119: 96%
Entrez Gene ID: 64393
Uniprot ID: Q9HA38
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GPYFNPRSRQRIPRDLAMCVTPSGQFYCSMCNVGAGEEMEFRQHLESKQHKSKVSEQRYRNEMENLGYV
• Gene Sequence: GPYFNPRSRQRIPRDLAMCVTPSGQFYCSMCNVGAGEEMEFRQHLESKQHKSKVSEQRYRNEMENLGYV
• Gene ID - Mouse: ENSMUSG00000027663
• Gene ID - Rat: ENSRNOG00000010119
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.