Anti ZKSCAN7 pAb (ATL-HPA049906)

Atlas Antibodies

SKU:
ATL-HPA049906-25
  • Immunohistochemical staining of human kidney shows cytoplsmic positivity in cells in tubules.
  • Immunofluorescent staining of human cell line Hep G2 shows localization to cytosol.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: zinc finger with KRAB and SCAN domains 7
Gene Name: ZKSCAN7
Alternative Gene Name: FLJ12738, ZNF167, ZNF448, ZNF64, ZSCAN39
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063488: 39%, ENSRNOG00000004104: 45%
Entrez Gene ID: 55888
Uniprot ID: Q9P0L1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PAQKQEMHFEETTALGTTKESPPTSPLSGGSAPGAHLEPPYDPGTHHLPSGDFAQCTSPVPTLPQVGNSGDQAG
Gene Sequence PAQKQEMHFEETTALGTTKESPPTSPLSGGSAPGAHLEPPYDPGTHHLPSGDFAQCTSPVPTLPQVGNSGDQAG
Gene ID - Mouse ENSMUSG00000063488
Gene ID - Rat ENSRNOG00000004104
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ZKSCAN7 pAb (ATL-HPA049906)
Datasheet Anti ZKSCAN7 pAb (ATL-HPA049906) Datasheet (External Link)
Vendor Page Anti ZKSCAN7 pAb (ATL-HPA049906) at Atlas Antibodies

Documents & Links for Anti ZKSCAN7 pAb (ATL-HPA049906)
Datasheet Anti ZKSCAN7 pAb (ATL-HPA049906) Datasheet (External Link)
Vendor Page Anti ZKSCAN7 pAb (ATL-HPA049906)