Anti ZKSCAN3 pAb (ATL-HPA060116)

Atlas Antibodies

SKU: ATL-HPA060116-25

• 

Protein Description: zinc finger with KRAB and SCAN domains 3
Gene Name: ZKSCAN3
Alternative Gene Name: ZF47, Zfp47, ZNF306, ZNF309, ZSCAN35
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021327: 48%, ENSRNOG00000055000: 45%
Entrez Gene ID: 80317
Uniprot ID: Q9BRR0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AQSTEDQMELLVIKVEEEEAGFPSSPDLGSEGS
• Gene Sequence: AQSTEDQMELLVIKVEEEEAGFPSSPDLGSEGS
• Gene ID - Mouse: ENSMUSG00000021327
• Gene ID - Rat: ENSRNOG00000055000
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.