Anti ZIK1 pAb (ATL-HPA059975)

Atlas Antibodies

SKU: ATL-HPA059975-25

• 
• 

Protein Description: zinc finger protein interacting with K protein 1
Gene Name: ZIK1
Alternative Gene Name: ZNF762
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030393: 44%, ENSRNOG00000055843: 42%
Entrez Gene ID: 284307
Uniprot ID: Q3SY52
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CMSLKPFRKWEVGKDLPAMLRLLRSLVFPGGKKPGTITECGEDIRSQKSHYKSGECGKASRH
• Gene Sequence: CMSLKPFRKWEVGKDLPAMLRLLRSLVFPGGKKPGTITECGEDIRSQKSHYKSGECGKASRH
• Gene ID - Mouse: ENSMUSG00000030393
• Gene ID - Rat: ENSRNOG00000055843
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.