Anti ZIC3 pAb (ATL-HPA052936)

Atlas Antibodies

SKU: ATL-HPA052936-25

• 

Protein Description: Zic family member 3
Gene Name: ZIC3
Alternative Gene Name: HTX, HTX1, ZNF203
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000067860: 100%, ENSRNOG00000000861: 100%
Entrez Gene ID: 7547
Uniprot ID: O60481
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HEQGAGHPSPTGHVDNNQVHLGLRGELFGRADPYRPVA
• Gene Sequence: HEQGAGHPSPTGHVDNNQVHLGLRGELFGRADPYRPVA
• Gene ID - Mouse: ENSMUSG00000067860
• Gene ID - Rat: ENSRNOG00000000861
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.