Anti ZG16B pAb (ATL-HPA053549 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA053549-25
  • Immunohistochemistry analysis in human salivary gland and testis tissues using HPA053549 antibody. Corresponding ZG16B RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line PC-3 shows localization to nucleoplasm & vesicles.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: zymogen granule protein 16B
Gene Name: ZG16B
Alternative Gene Name: HRPE773, JCLN2, PRO1567
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049350: 26%, ENSRNOG00000000341: 27%
Entrez Gene ID: 124220
Uniprot ID: Q96DA0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AFLRGMVMYTSKDRYFYFGKLDGQISSAYPSQEGQVLVGIYGQYQLLGIKSIGFEWNYPLEEPTTEPPVNLTYSANSPVG
Gene Sequence AFLRGMVMYTSKDRYFYFGKLDGQISSAYPSQEGQVLVGIYGQYQLLGIKSIGFEWNYPLEEPTTEPPVNLTYSANSPVG
Gene ID - Mouse ENSMUSG00000049350
Gene ID - Rat ENSRNOG00000000341
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ZG16B pAb (ATL-HPA053549 w/enhanced validation)
Datasheet Anti ZG16B pAb (ATL-HPA053549 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ZG16B pAb (ATL-HPA053549 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ZG16B pAb (ATL-HPA053549 w/enhanced validation)
Datasheet Anti ZG16B pAb (ATL-HPA053549 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ZG16B pAb (ATL-HPA053549 w/enhanced validation)