Anti ZG16 pAb (ATL-HPA052512 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA052512-25
  • Immunohistochemistry analysis in human rectum and testis tissues using HPA052512 antibody. Corresponding ZG16 RNA-seq data are presented for the same tissues.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and ZG16 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY407589).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: zymogen granule protein 16
Gene Name: ZG16
Alternative Gene Name: hZG16, JCLN, JCLN1, ZG16A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049350: 87%, ENSRNOG00000016857: 87%
Entrez Gene ID: 653808
Uniprot ID: O60844
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RSSSYSGEYGSGGGKRFSHSGNQLDGPITALRVRVNTYYIVGLQVRYGKVWSDYVGGRNGDLEEIFLHPGE
Gene Sequence RSSSYSGEYGSGGGKRFSHSGNQLDGPITALRVRVNTYYIVGLQVRYGKVWSDYVGGRNGDLEEIFLHPGE
Gene ID - Mouse ENSMUSG00000049350
Gene ID - Rat ENSRNOG00000016857
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ZG16 pAb (ATL-HPA052512 w/enhanced validation)
Datasheet Anti ZG16 pAb (ATL-HPA052512 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ZG16 pAb (ATL-HPA052512 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ZG16 pAb (ATL-HPA052512 w/enhanced validation)
Datasheet Anti ZG16 pAb (ATL-HPA052512 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ZG16 pAb (ATL-HPA052512 w/enhanced validation)



Citations for Anti ZG16 pAb (ATL-HPA052512 w/enhanced validation) – 1 Found
Wang, Wei; Sun, Jian-Fang; Wang, Xiao-Zhong; Ying, Hou-Qun; You, Xia-Hong; Sun, Fan. A Novel Prognostic Score Based on ZG16 for Predicting CRC Survival. Pharmacogenomics And Personalized Medicine. 13( 33364813):735-747.  PubMed