Protein Description: zinc finger, FYVE domain containing 27
Gene Name: ZFYVE27
Alternative Gene Name: FLJ32919, SPG33
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018820: 63%, ENSRNOG00000014903: 63%
Entrez Gene ID: 118813
Uniprot ID: Q5T4F4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZFYVE27
Alternative Gene Name: FLJ32919, SPG33
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018820: 63%, ENSRNOG00000014903: 63%
Entrez Gene ID: 118813
Uniprot ID: Q5T4F4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | VEFFRVVSEYRASLQQRMNPKQEEHAFESPPPPDVGGKDGLMDSTPALTPTE |
| Gene ID - Mouse | ENSMUSG00000018820 |
| Gene ID - Rat | ENSMUSG00000018820 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ZFYVE27 pAb (ATL-HPA069876) | |
| Datasheet | Anti ZFYVE27 pAb (ATL-HPA069876) Datasheet (External Link) |
| Vendor Page | Anti ZFYVE27 pAb (ATL-HPA069876) at Atlas |
| Documents & Links for Anti ZFYVE27 pAb (ATL-HPA069876) | |
| Datasheet | Anti ZFYVE27 pAb (ATL-HPA069876) Datasheet (External Link) |
| Vendor Page | Anti ZFYVE27 pAb (ATL-HPA069876) |