Anti ZFYVE27 pAb (ATL-HPA069876)

Atlas Antibodies

SKU: ATL-HPA069876-100

• 
• 

Protein Description: zinc finger, FYVE domain containing 27
Gene Name: ZFYVE27
Alternative Gene Name: FLJ32919, SPG33
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018820: 63%, ENSRNOG00000014903: 63%
Entrez Gene ID: 118813
Uniprot ID: Q5T4F4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VEFFRVVSEYRASLQQRMNPKQEEHAFESPPPPDVGGKDGLMDSTPALTPTE
• Gene Sequence: VEFFRVVSEYRASLQQRMNPKQEEHAFESPPPPDVGGKDGLMDSTPALTPTE
• Gene ID - Mouse: ENSMUSG00000018820
• Gene ID - Rat: ENSRNOG00000014903
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.