Protein Description: zinc finger protein, Y-linked
Gene Name: ZFY
Alternative Gene Name: ZNF911
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079509: 96%, ENSRNOG00000005624: 94%
Entrez Gene ID: 7544
Uniprot ID: P08048
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZFY
Alternative Gene Name: ZNF911
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079509: 96%, ENSRNOG00000005624: 94%
Entrez Gene ID: 7544
Uniprot ID: P08048
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | KTHIKTKHSKEMPFKCDICLLTFSDTKEVQQHTLVHQESKTHQCLHCD |
Documents & Links for Anti ZFY pAb (ATL-HPA071863) | |
Datasheet | Anti ZFY pAb (ATL-HPA071863) Datasheet (External Link) |
Vendor Page | Anti ZFY pAb (ATL-HPA071863) at Atlas |
Documents & Links for Anti ZFY pAb (ATL-HPA071863) | |
Datasheet | Anti ZFY pAb (ATL-HPA071863) Datasheet (External Link) |
Vendor Page | Anti ZFY pAb (ATL-HPA071863) |