Anti ZFR2 pAb (ATL-HPA055678)

Atlas Antibodies

SKU: ATL-HPA055678-25

• 

Protein Description: zinc finger RNA binding protein 2
Gene Name: ZFR2
Alternative Gene Name: KIAA1086
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022201: 31%, ENSRNOG00000011627: 31%
Entrez Gene ID: 23217
Uniprot ID: Q9UPR6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YQDSYSYGQSAAARSYEDRPYFQSAALQSGRMTAADSGQPGTQEACGQPSPHGSHSHAQPPQQAPIVESGQPASTLSSGYT
• Gene Sequence: YQDSYSYGQSAAARSYEDRPYFQSAALQSGRMTAADSGQPGTQEACGQPSPHGSHSHAQPPQQAPIVESGQPASTLSSGYT
• Gene ID - Mouse: ENSMUSG00000022201
• Gene ID - Rat: ENSRNOG00000011627
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.