Anti ZFP57 pAb (ATL-HPA047172)

Atlas Antibodies

SKU: ATL-HPA047172-25

• 

Protein Description: ZFP57 zinc finger protein
Gene Name: ZFP57
Alternative Gene Name: bA145L22, bA145L22.2, C6orf40, ZNF698
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059975: 31%, ENSRNOG00000027282: 28%
Entrez Gene ID: 346171
Uniprot ID: Q9NU63
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PELITKLEQEEEQWREFVHLPNTEGLSEGKKKELREQHPSLRDEGTSDDKVFLACRGAGQCPLSAPAGTMDRTRVLQASQAGPPF
• Gene Sequence: PELITKLEQEEEQWREFVHLPNTEGLSEGKKKELREQHPSLRDEGTSDDKVFLACRGAGQCPLSAPAGTMDRTRVLQASQAGPPF
• Gene ID - Mouse: ENSMUSG00000059975
• Gene ID - Rat: ENSRNOG00000027282
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.