Anti ZFP37 pAb (ATL-HPA049112)

Atlas Antibodies

SKU:
ATL-HPA049112-25
  • Immunohistochemical staining of human bone marrow shows strong cytoplasmic positivity in subset of hematopoietic cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & vesicles.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ZFP37 zinc finger protein
Gene Name: ZFP37
Alternative Gene Name: ZNF906
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028389: 42%, ENSRNOG00000030118: 31%
Entrez Gene ID: 7539
Uniprot ID: Q9Y6Q3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MSVSSGDQILTKPETVDRRRSAETTKEAGRPLEMAVSEPEASAAEWKQLDP
Gene Sequence MSVSSGDQILTKPETVDRRRSAETTKEAGRPLEMAVSEPEASAAEWKQLDP
Gene ID - Mouse ENSMUSG00000028389
Gene ID - Rat ENSRNOG00000030118
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ZFP37 pAb (ATL-HPA049112)
Datasheet Anti ZFP37 pAb (ATL-HPA049112) Datasheet (External Link)
Vendor Page Anti ZFP37 pAb (ATL-HPA049112) at Atlas Antibodies

Documents & Links for Anti ZFP37 pAb (ATL-HPA049112)
Datasheet Anti ZFP37 pAb (ATL-HPA049112) Datasheet (External Link)
Vendor Page Anti ZFP37 pAb (ATL-HPA049112)