Anti ZFP3 pAb (ATL-HPA053085)

Atlas Antibodies

SKU:
ATL-HPA053085-25
  • Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ZFP3 zinc finger protein
Gene Name: ZFP3
Alternative Gene Name: FLJ30726, ZNF752
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043602: 61%, ENSRNOG00000005009: 68%
Entrez Gene ID: 124961
Uniprot ID: Q96NJ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GTENKEVIPKEEISEESEPHGSLLEKFPKVVYQGHEFGAGCEEDMLEGHSRESMEEVIEQMSPQER
Gene Sequence GTENKEVIPKEEISEESEPHGSLLEKFPKVVYQGHEFGAGCEEDMLEGHSRESMEEVIEQMSPQER
Gene ID - Mouse ENSMUSG00000043602
Gene ID - Rat ENSRNOG00000005009
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ZFP3 pAb (ATL-HPA053085)
Datasheet Anti ZFP3 pAb (ATL-HPA053085) Datasheet (External Link)
Vendor Page Anti ZFP3 pAb (ATL-HPA053085) at Atlas Antibodies

Documents & Links for Anti ZFP3 pAb (ATL-HPA053085)
Datasheet Anti ZFP3 pAb (ATL-HPA053085) Datasheet (External Link)
Vendor Page Anti ZFP3 pAb (ATL-HPA053085)