Anti ZDHHC21 pAb (ATL-HPA065254)

Atlas Antibodies

SKU: ATL-HPA065254-25

• 
• 

Protein Description: zinc finger, DHHC-type containing 21
Gene Name: ZDHHC21
Alternative Gene Name: DNZ1, HSPC097
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028403: 94%, ENSRNOG00000010484: 94%
Entrez Gene ID: 340481
Uniprot ID: Q8IVQ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RASITDPGRLPENPKIPHGEREFWELCNKCNLMRPKRSHHCSRCGHCVRRM
• Gene Sequence: RASITDPGRLPENPKIPHGEREFWELCNKCNLMRPKRSHHCSRCGHCVRRM
• Gene ID - Mouse: ENSMUSG00000028403
• Gene ID - Rat: ENSRNOG00000010484
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.