Anti ZDHHC17 pAb (ATL-HPA058674)

Atlas Antibodies

SKU: ATL-HPA058674-25

• 

Protein Description: zinc finger DHHC-type containing 17
Gene Name: ZDHHC17
Alternative Gene Name: HIP14, HYPH, KIAA0946
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035798: 100%, ENSRNOG00000003803: 100%
Entrez Gene ID: 23390
Uniprot ID: Q8IUH5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LGITTNERMNARRYKHFKVTTTSIESPFNHGCVRNIIDFFEFRCCGLFRPVIVDWTRQYTIEYDQISGSGYQL
• Gene Sequence: LGITTNERMNARRYKHFKVTTTSIESPFNHGCVRNIIDFFEFRCCGLFRPVIVDWTRQYTIEYDQISGSGYQL
• Gene ID - Mouse: ENSMUSG00000035798
• Gene ID - Rat: ENSRNOG00000003803
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.