Anti ZDHHC1 pAb (ATL-HPA048659)

Atlas Antibodies

SKU: ATL-HPA048659-25

• 

Protein Description: zinc finger, DHHC-type containing 1
Gene Name: ZDHHC1
Alternative Gene Name: C16orf1, HSU90653, ZNF377
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039199: 96%, ENSRNOG00000017045: 96%
Entrez Gene ID: 29800
Uniprot ID: Q8WTX9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DPADANVRDKSYAGPLPIFNRSQHAHVIEDLHCNLCNVDVSARSKHCS
• Gene Sequence: DPADANVRDKSYAGPLPIFNRSQHAHVIEDLHCNLCNVDVSARSKHCS
• Gene ID - Mouse: ENSMUSG00000039199
• Gene ID - Rat: ENSRNOG00000017045
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.