Anti ZCCHC9 pAb (ATL-HPA057521)

Atlas Antibodies

SKU: ATL-HPA057521-25

• 

Protein Description: zinc finger, CCHC domain containing 9
Gene Name: ZCCHC9
Alternative Gene Name: DKFZp761J139, PPP1R41
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021621: 88%, ENSRNOG00000051682: 89%
Entrez Gene ID: 84240
Uniprot ID: Q8N567
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LGEFPFAKCFVCGEMGHLSRSCPDNPKGLYADGGGCKLCGSVEHLKKDCPESQNSERMVTVGRWAKGMSADYE
• Gene Sequence: LGEFPFAKCFVCGEMGHLSRSCPDNPKGLYADGGGCKLCGSVEHLKKDCPESQNSERMVTVGRWAKGMSADYE
• Gene ID - Mouse: ENSMUSG00000021621
• Gene ID - Rat: ENSRNOG00000051682
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.