Anti ZC3H14 pAb (ATL-HPA053510 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA053510-25
  • Immunohistochemistry analysis in human testis and liver tissues using HPA053510 antibody. Corresponding ZC3H14 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli & nuclear speckles.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: zinc finger CCCH-type containing 14
Gene Name: ZC3H14
Alternative Gene Name: FLJ11806, NY-REN-37, UKp68
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021012: 88%, ENSRNOG00000004083: 85%
Entrez Gene ID: 79882
Uniprot ID: Q6PJT7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LILKAISEAQESVTKTTNYSTVPQKQTLPVAPRTRTSQEELLAEVVQGQSRTPRISPPIKEEETKGDSVEKNQGTQQRQLLSRLQIDPVMA
Gene Sequence LILKAISEAQESVTKTTNYSTVPQKQTLPVAPRTRTSQEELLAEVVQGQSRTPRISPPIKEEETKGDSVEKNQGTQQRQLLSRLQIDPVMA
Gene ID - Mouse ENSMUSG00000021012
Gene ID - Rat ENSRNOG00000004083
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti ZC3H14 pAb (ATL-HPA053510 w/enhanced validation)
Datasheet Anti ZC3H14 pAb (ATL-HPA053510 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ZC3H14 pAb (ATL-HPA053510 w/enhanced validation)