Anti ZC3H14 pAb (ATL-HPA049798 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA049798-25
  • Immunohistochemistry analysis in human testis and liver tissues using HPA049798 antibody. Corresponding ZC3H14 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line MCF7 shows localization to nuclear speckles.
  • Western blot analysis in human cell line RH-30.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: zinc finger CCCH-type containing 14
Gene Name: ZC3H14
Alternative Gene Name: FLJ11806, NY-REN-37, UKp68
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021012: 82%, ENSRNOG00000004083: 82%
Entrez Gene ID: 79882
Uniprot ID: Q6PJT7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RPSIEIYRPPASRNADSGVHLNRLQFQQQQNSIHAAKQLDMQSSWVYETGRLCEPEVLNSLEETYSPFFRNNSEKMSMEDENFRKRKLPVVSSVVKVK
Gene Sequence RPSIEIYRPPASRNADSGVHLNRLQFQQQQNSIHAAKQLDMQSSWVYETGRLCEPEVLNSLEETYSPFFRNNSEKMSMEDENFRKRKLPVVSSVVKVK
Gene ID - Mouse ENSMUSG00000021012
Gene ID - Rat ENSRNOG00000004083
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti ZC3H14 pAb (ATL-HPA049798 w/enhanced validation)
Datasheet Anti ZC3H14 pAb (ATL-HPA049798 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ZC3H14 pAb (ATL-HPA049798 w/enhanced validation)



Citations for Anti ZC3H14 pAb (ATL-HPA049798 w/enhanced validation) – 1 Found
Viphakone, Nicolas; Sudbery, Ian; Griffith, Llywelyn; Heath, Catherine G; Sims, David; Wilson, Stuart A. Co-transcriptional Loading of RNA Export Factors Shapes the Human Transcriptome. Molecular Cell. 2019;75(2):310-323.e8.  PubMed