Anti ZC2HC1C pAb (ATL-HPA050928)

Atlas Antibodies

SKU:
ATL-HPA050928-25
  • Immunohistochemical staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts and Leydig cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear speckles & mitochondria.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: zinc finger, C2HC-type containing 1C
Gene Name: ZC2HC1C
Alternative Gene Name: C14orf140, FAM164C
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045064: 53%, ENSRNOG00000027115: 53%
Entrez Gene ID: 79696
Uniprot ID: Q53FD0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ENENGELQKIILPRSRVKGNKSNTMYKPIFSPEFEFEEEFSRDRREDETWGRSQQNSVPFQFSDYRIQRLKRERLVASNNKIRDP
Gene Sequence ENENGELQKIILPRSRVKGNKSNTMYKPIFSPEFEFEEEFSRDRREDETWGRSQQNSVPFQFSDYRIQRLKRERLVASNNKIRDP
Gene ID - Mouse ENSMUSG00000045064
Gene ID - Rat ENSRNOG00000027115
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ZC2HC1C pAb (ATL-HPA050928)
Datasheet Anti ZC2HC1C pAb (ATL-HPA050928) Datasheet (External Link)
Vendor Page Anti ZC2HC1C pAb (ATL-HPA050928) at Atlas Antibodies

Documents & Links for Anti ZC2HC1C pAb (ATL-HPA050928)
Datasheet Anti ZC2HC1C pAb (ATL-HPA050928) Datasheet (External Link)
Vendor Page Anti ZC2HC1C pAb (ATL-HPA050928)