Anti ZBTB8B pAb (ATL-HPA055553)

Atlas Antibodies

SKU: ATL-HPA055553-25

• 

Protein Description: zinc finger and BTB domain containing 8B
Gene Name: ZBTB8B
Alternative Gene Name: DKFZp547H154, RP1-27O5.1, ZNF916B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048485: 84%, ENSRNOG00000026898: 88%
Entrez Gene ID: 728116
Uniprot ID: Q8NAP8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SNRPIICKGCRRTFTSHLSQGLRRFGLCDSCTCVTDTPDDDDDLMPINLSLVEASSESQEKSDTDNDWPIYVESEI
• Gene Sequence: SNRPIICKGCRRTFTSHLSQGLRRFGLCDSCTCVTDTPDDDDDLMPINLSLVEASSESQEKSDTDNDWPIYVESEI
• Gene ID - Mouse: ENSMUSG00000048485
• Gene ID - Rat: ENSRNOG00000026898
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.