Anti ZBTB7A pAb (ATL-HPA046387)

Atlas Antibodies

SKU: ATL-HPA046387-25

• 
• 

Protein Description: zinc finger and BTB domain containing 7A
Gene Name: ZBTB7A
Alternative Gene Name: DKFZp547O146, FBI-1, LRF, pokemon, ZBTB7, ZNF857A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035011: 76%, ENSRNOG00000020161: 74%
Entrez Gene ID: 51341
Uniprot ID: O95365
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AVSHVCADLLDRQILAADAGADAGQLDLVDQIDQRNLLRAKEYLEFFQSN
• Gene Sequence: AVSHVCADLLDRQILAADAGADAGQLDLVDQIDQRNLLRAKEYLEFFQSN
• Gene ID - Mouse: ENSMUSG00000035011
• Gene ID - Rat: ENSRNOG00000020161
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.