Anti ZBTB44 pAb (ATL-HPA052589)

Atlas Antibodies

SKU: ATL-HPA052589-25

• 
• 

Protein Description: zinc finger and BTB domain containing 44
Gene Name: ZBTB44
Alternative Gene Name: BTBD15, HSPC063, ZNF851
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047412: 97%, ENSRNOG00000043223: 27%
Entrez Gene ID: 29068
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SFGEYKHHMRVSRHIIRKPRIYECKTCGAMFTNSGNLIVHLRSLNHEASELANYFQSSDFLVPDYLNQEQEETLVQYDLGEHGFESNSSVQMPVISQYHS
• Gene Sequence: SFGEYKHHMRVSRHIIRKPRIYECKTCGAMFTNSGNLIVHLRSLNHEASELANYFQSSDFLVPDYLNQEQEETLVQYDLGEHGFESNSSVQMPVISQYHS
• Gene ID - Mouse: ENSMUSG00000047412
• Gene ID - Rat: ENSRNOG00000043223
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.