Anti ZBTB25 pAb (ATL-HPA054699)

Atlas Antibodies

SKU: ATL-HPA054699-25

• 
• 

Protein Description: zinc finger and BTB domain containing 25
Gene Name: ZBTB25
Alternative Gene Name: C14orf51, KUP, ZNF46
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056459: 84%, ENSRNOG00000006441: 86%
Entrez Gene ID: 7597
Uniprot ID: P24278
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IGLDDGTADQQRACPATQALEEHQKPPVSIKQERCDPESVISQSHPSPSSEVTGPTFTENSVKIHLCHYCGERFDSRSNLR
• Gene Sequence: IGLDDGTADQQRACPATQALEEHQKPPVSIKQERCDPESVISQSHPSPSSEVTGPTFTENSVKIHLCHYCGERFDSRSNLR
• Gene ID - Mouse: ENSMUSG00000056459
• Gene ID - Rat: ENSRNOG00000006441
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.