Anti ZBTB12 pAb (ATL-HPA047161)

Atlas Antibodies

SKU: ATL-HPA047161-25

• 

Protein Description: zinc finger and BTB domain containing 12
Gene Name: ZBTB12
Alternative Gene Name: C6orf46, D6S59E, G10, NG35
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049823: 83%, ENSRNOG00000000418: 89%
Entrez Gene ID: 221527
Uniprot ID: Q9Y330
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GLGIGGSVGGHLGELAQSSVPPSTVAPPQGVVKACY
• Gene Sequence: GLGIGGSVGGHLGELAQSSVPPSTVAPPQGVVKACY
• Gene ID - Mouse: ENSMUSG00000049823
• Gene ID - Rat: ENSRNOG00000000418
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.