Anti ZBTB10 pAb (ATL-HPA050569)

Atlas Antibodies

SKU: ATL-HPA050569-25

• 

Protein Description: zinc finger and BTB domain containing 10
Gene Name: ZBTB10
Alternative Gene Name: FLJ12752, RINZF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069114: 93%, ENSRNOG00000061862: 94%
Entrez Gene ID: 65986
Uniprot ID: Q96DT7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AGEGETVQHFPLARPKSLMQKLQCSFQTSWLKDFPWLRYSKDTGLMSCGWCQKTPADGGSVDLPPVGHDELSRGTRNYKKTLLLRHHVSTEHKLHEAN
• Gene Sequence: AGEGETVQHFPLARPKSLMQKLQCSFQTSWLKDFPWLRYSKDTGLMSCGWCQKTPADGGSVDLPPVGHDELSRGTRNYKKTLLLRHHVSTEHKLHEAN
• Gene ID - Mouse: ENSMUSG00000069114
• Gene ID - Rat: ENSRNOG00000061862
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.