Anti ZBTB1 pAb (ATL-HPA050516)

Atlas Antibodies

SKU: ATL-HPA050516-25

• 
• 
• 

Protein Description: zinc finger and BTB domain containing 1
Gene Name: ZBTB1
Alternative Gene Name: KIAA0997, ZNF909
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033454: 89%, ENSRNOG00000058593: 79%
Entrez Gene ID: 22890
Uniprot ID: Q9Y2K1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CDSCGFGFSCEKLLDEHVLTCTNRHLYQNTRSYHRIVDIRDGKDSNIKAEFGEKDSSKTFSAQTDKYRGDTSQAADDSASTTGSRK
• Gene Sequence: CDSCGFGFSCEKLLDEHVLTCTNRHLYQNTRSYHRIVDIRDGKDSNIKAEFGEKDSSKTFSAQTDKYRGDTSQAADDSASTTGSRK
• Gene ID - Mouse: ENSMUSG00000033454
• Gene ID - Rat: ENSRNOG00000058593
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.