Anti ZBED5 pAb (ATL-HPA050994)

Atlas Antibodies

SKU: ATL-HPA050994-25

• 
• 
• 

Protein Description: zinc finger, BED-type containing 5
Gene Name: ZBED5
Alternative Gene Name: Buster1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029624: 21%, ENSRNOG00000046254: 26%
Entrez Gene ID: 58486
Uniprot ID: Q49AG3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IAPLLCILSYNFNTFAILNVYSKLTMFCTTNSLPMDLLLKQGSLKQEVESFCYQIVSESNDQKVGILQSEDKQLQPSVSKKSEGELSR
• Gene Sequence: IAPLLCILSYNFNTFAILNVYSKLTMFCTTNSLPMDLLLKQGSLKQEVESFCYQIVSESNDQKVGILQSEDKQLQPSVSKKSEGELSR
• Gene ID - Mouse: ENSMUSG00000029624
• Gene ID - Rat: ENSRNOG00000046254
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.