Anti ZBED4 pAb (ATL-HPA045341)

Atlas Antibodies

SKU:
ATL-HPA045341-100
  • Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: zinc finger, BED-type containing 4
Gene Name: ZBED4
Alternative Gene Name: KIAA0637
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034333: 81%, ENSRNOG00000004588: 81%
Entrez Gene ID: 9889
Uniprot ID: O75132
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen PPDSLERMDFKSEQEDMKQTDSGGERAGLGGTGCSCKPPGKYLSAESEDDYGALFSQYSSTLYDVAMEAVTQSLLSSRNMSSRKKSPAWKHFFISPRDSTKAICMYCVKEFSRGKNEKDLSTSCLMRHVRRAHPTVLIQ
Gene Sequence PPDSLERMDFKSEQEDMKQTDSGGERAGLGGTGCSCKPPGKYLSAESEDDYGALFSQYSSTLYDVAMEAVTQSLLSSRNMSSRKKSPAWKHFFISPRDSTKAICMYCVKEFSRGKNEKDLSTSCLMRHVRRAHPTVLIQ
Gene ID - Mouse ENSMUSG00000034333
Gene ID - Rat ENSRNOG00000004588
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ZBED4 pAb (ATL-HPA045341)
Datasheet Anti ZBED4 pAb (ATL-HPA045341) Datasheet (External Link)
Vendor Page Anti ZBED4 pAb (ATL-HPA045341) at Atlas Antibodies

Documents & Links for Anti ZBED4 pAb (ATL-HPA045341)
Datasheet Anti ZBED4 pAb (ATL-HPA045341) Datasheet (External Link)
Vendor Page Anti ZBED4 pAb (ATL-HPA045341)