Anti YJEFN3 pAb (ATL-HPA060789)
Atlas Antibodies
- SKU:
- ATL-HPA060789-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: YJEFN3
Alternative Gene Name: FLJ44968, hYjeF_N3-19p13.11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048967: 81%, ENSRNOG00000039191: 81%
Entrez Gene ID: 374887
Uniprot ID: A6XGL0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SGWDAETGSDSEDGLRPDVLVSLAAPKRCAGRFSGRHHFVAGRFVPDDVRRKFALRLPGYTGTD |
Gene Sequence | SGWDAETGSDSEDGLRPDVLVSLAAPKRCAGRFSGRHHFVAGRFVPDDVRRKFALRLPGYTGTD |
Gene ID - Mouse | ENSMUSG00000048967 |
Gene ID - Rat | ENSRNOG00000039191 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti YJEFN3 pAb (ATL-HPA060789) | |
Datasheet | Anti YJEFN3 pAb (ATL-HPA060789) Datasheet (External Link) |
Vendor Page | Anti YJEFN3 pAb (ATL-HPA060789) at Atlas Antibodies |
Documents & Links for Anti YJEFN3 pAb (ATL-HPA060789) | |
Datasheet | Anti YJEFN3 pAb (ATL-HPA060789) Datasheet (External Link) |
Vendor Page | Anti YJEFN3 pAb (ATL-HPA060789) |