Anti YIPF1 pAb (ATL-HPA073931)
Atlas Antibodies
- SKU:
- ATL-HPA073931-25
![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/101208/181278/atl-hpa073931_anti-yipf1-pab-atl-hpa073931_62946__10523.1681137568.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil")
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: YIPF1
Alternative Gene Name: DJ167A19.1, FinGER1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057375: 71%, ENSRNOG00000010512: 73%
Entrez Gene ID: 54432
Uniprot ID: Q9Y548
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MAAVDDLQFEEFGNAATSLTANPDATTVNIEDPGETPKHQPGSPRGSGREED |
| Gene Sequence | MAAVDDLQFEEFGNAATSLTANPDATTVNIEDPGETPKHQPGSPRGSGREED |
| Gene ID - Mouse | ENSMUSG00000057375 |
| Gene ID - Rat | ENSRNOG00000010512 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti YIPF1 pAb (ATL-HPA073931) | |
| Datasheet | Anti YIPF1 pAb (ATL-HPA073931) Datasheet (External Link) |
| Vendor Page | Anti YIPF1 pAb (ATL-HPA073931) at Atlas Antibodies |
| Documents & Links for Anti YIPF1 pAb (ATL-HPA073931) | |
| Datasheet | Anti YIPF1 pAb (ATL-HPA073931) Datasheet (External Link) |
| Vendor Page | Anti YIPF1 pAb (ATL-HPA073931) |