Anti YBX1 pAb (ATL-HPA057159)

Atlas Antibodies

SKU: ATL-HPA057159-25

• 

Protein Description: Y box binding protein 1
Gene Name: YBX1
Alternative Gene Name: BP-8, CSDA2, CSDB, DBPB, MDR-NF1, NSEP-1, NSEP1, YB-1, YB1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028639: 100%, ENSRNOG00000032902: 100%
Entrez Gene ID: 4904
Uniprot ID: P67809
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TQGQQPPQRRYRRNFNYRRRRPENPKPQDGKETKAADPPAENSSAPEAEQ
• Gene Sequence: TQGQQPPQRRYRRNFNYRRRRPENPKPQDGKETKAADPPAENSSAPEAEQ
• Gene ID - Mouse: ENSMUSG00000028639
• Gene ID - Rat: ENSRNOG00000032902
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.