Anti XRN2 pAb (ATL-HPA047118)

Atlas Antibodies

SKU:
ATL-HPA047118-25
  • Immunohistochemical staining of human Lymph node shows strong nuclear positivity in germinal and non-germinal center cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & nucleoli.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: 5'-3' exoribonuclease 2
Gene Name: XRN2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027433: 90%, ENSRNOG00000011785: 91%
Entrez Gene ID: 22803
Uniprot ID: Q9H0D6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NSLGGDVLFVGKHHPLHDFILELYQTGSTEPVEVPPELCHGVQGKFSLDEEAILPDQIVCSPVPMLRDLTQNTVVSINFKDPQFAEDYIFKAVMLPGARKPAA
Gene Sequence NSLGGDVLFVGKHHPLHDFILELYQTGSTEPVEVPPELCHGVQGKFSLDEEAILPDQIVCSPVPMLRDLTQNTVVSINFKDPQFAEDYIFKAVMLPGARKPAA
Gene ID - Mouse ENSMUSG00000027433
Gene ID - Rat ENSRNOG00000011785
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti XRN2 pAb (ATL-HPA047118)
Datasheet Anti XRN2 pAb (ATL-HPA047118) Datasheet (External Link)
Vendor Page Anti XRN2 pAb (ATL-HPA047118) at Atlas Antibodies

Documents & Links for Anti XRN2 pAb (ATL-HPA047118)
Datasheet Anti XRN2 pAb (ATL-HPA047118) Datasheet (External Link)
Vendor Page Anti XRN2 pAb (ATL-HPA047118)