Anti XRCC6 pAb (ATL-HPA062226 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA062226-25

• 
• 
• 

Product Description

Protein Description: X-ray repair complementing defective repair in Chinese hamster cells 6
Gene Name: XRCC6
Alternative Gene Name: D22S671, D22S731, G22P1, KU70, ML8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022471: 90%, ENSRNOG00000006392: 94%
Entrez Gene ID: 2547
Uniprot ID: P12956
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DVQFKMSHKRIMLFTNEDNPHGNDSAKASRARTKAGDLRDTGIFLDLMHLKKPGGFDISLFYRDIISIAEDEDLRVHFEESSKLEDLLRKVRAKETR
• Gene Sequence: DVQFKMSHKRIMLFTNEDNPHGNDSAKASRARTKAGDLRDTGIFLDLMHLKKPGGFDISLFYRDIISIAEDEDLRVHFEESSKLEDLLRKVRAKETR
• Gene ID - Mouse: ENSMUSG00000022471
• Gene ID - Rat: ENSRNOG00000006392
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links