Anti XRCC3 pAb (ATL-HPA062422)

Atlas Antibodies

SKU: ATL-HPA062422-25

• 

Protein Description: X-ray repair complementing defective repair in Chinese hamster cells 3
Gene Name: XRCC3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021287: 55%, ENSRNOG00000012141: 58%
Entrez Gene ID: 7517
Uniprot ID: O43542
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NQVTEAMEEQGAAHGPLGFWDERVSPALGITWANQLLVRLLADRLREEEAALGCPARTLRVLSA
• Gene Sequence: NQVTEAMEEQGAAHGPLGFWDERVSPALGITWANQLLVRLLADRLREEEAALGCPARTLRVLSA
• Gene ID - Mouse: ENSMUSG00000021287
• Gene ID - Rat: ENSRNOG00000012141
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.