Anti XPC pAb (ATL-HPA069673)
Atlas Antibodies
- SKU:
- ATL-HPA069673-25
- Shipping:
- Calculated at Checkout
$395.00
Product Description
Protein Description: xeroderma pigmentosum, complementation group C
Gene Name: XPC
Alternative Gene Name: RAD4, XPCC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030094: 75%, ENSRNOG00000008274: 77%
Entrez Gene ID: 7508
Uniprot ID: Q01831
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: XPC
Alternative Gene Name: RAD4, XPCC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030094: 75%, ENSRNOG00000008274: 77%
Entrez Gene ID: 7508
Uniprot ID: Q01831
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RALGNWKLLAKGLLIRERLKRRYGPKSEAAAPHTDAGGGLSSDEEEGTSSQAEAARILAASWPQNREDEEKQKLKGGPKKTKREKKAAASHLFPFEQ |
Gene Sequence | RALGNWKLLAKGLLIRERLKRRYGPKSEAAAPHTDAGGGLSSDEEEGTSSQAEAARILAASWPQNREDEEKQKLKGGPKKTKREKKAAASHLFPFEQ |
Gene ID - Mouse | ENSMUSG00000030094 |
Gene ID - Rat | ENSRNOG00000008274 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti XPC pAb (ATL-HPA069673) | |
Datasheet | Anti XPC pAb (ATL-HPA069673) Datasheet (External Link) |
Vendor Page | Anti XPC pAb (ATL-HPA069673) at Atlas Antibodies |
Documents & Links for Anti XPC pAb (ATL-HPA069673) | |
Datasheet | Anti XPC pAb (ATL-HPA069673) Datasheet (External Link) |
Vendor Page | Anti XPC pAb (ATL-HPA069673) |