Protein Description: xeroderma pigmentosum, complementation group C
Gene Name: XPC
Alternative Gene Name: RAD4, XPCC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030094: 75%, ENSRNOG00000008274: 77%
Entrez Gene ID: 7508
Uniprot ID: Q01831
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: XPC
Alternative Gene Name: RAD4, XPCC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030094: 75%, ENSRNOG00000008274: 77%
Entrez Gene ID: 7508
Uniprot ID: Q01831
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | RALGNWKLLAKGLLIRERLKRRYGPKSEAAAPHTDAGGGLSSDEEEGTSSQAEAARILAASWPQNREDEEKQKLKGGPKKTKREKKAAASHLFPFEQ |
| Documents & Links for Anti XPC pAb (ATL-HPA069673) | |
| Datasheet | Anti XPC pAb (ATL-HPA069673) Datasheet (External Link) |
| Vendor Page | Anti XPC pAb (ATL-HPA069673) at Atlas |
| Documents & Links for Anti XPC pAb (ATL-HPA069673) | |
| Datasheet | Anti XPC pAb (ATL-HPA069673) Datasheet (External Link) |
| Vendor Page | Anti XPC pAb (ATL-HPA069673) |