Anti XPC pAb (ATL-HPA069673)

Atlas Antibodies

SKU:
ATL-HPA069673-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus, plasma membrane & vesicles.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added

Product Description

Protein Description: xeroderma pigmentosum, complementation group C
Gene Name: XPC
Alternative Gene Name: RAD4, XPCC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030094: 75%, ENSRNOG00000008274: 77%
Entrez Gene ID: 7508
Uniprot ID: Q01831
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RALGNWKLLAKGLLIRERLKRRYGPKSEAAAPHTDAGGGLSSDEEEGTSSQAEAARILAASWPQNREDEEKQKLKGGPKKTKREKKAAASHLFPFEQ
Gene Sequence RALGNWKLLAKGLLIRERLKRRYGPKSEAAAPHTDAGGGLSSDEEEGTSSQAEAARILAASWPQNREDEEKQKLKGGPKKTKREKKAAASHLFPFEQ
Gene ID - Mouse ENSMUSG00000030094
Gene ID - Rat ENSRNOG00000008274
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti XPC pAb (ATL-HPA069673)
Datasheet Anti XPC pAb (ATL-HPA069673) Datasheet (External Link)
Vendor Page Anti XPC pAb (ATL-HPA069673) at Atlas Antibodies

Documents & Links for Anti XPC pAb (ATL-HPA069673)
Datasheet Anti XPC pAb (ATL-HPA069673) Datasheet (External Link)
Vendor Page Anti XPC pAb (ATL-HPA069673)