Anti XKR8 pAb (ATL-HPA049984)

Atlas Antibodies

SKU: ATL-HPA049984-25

• 

Protein Description: XK, Kell blood group complex subunit-related family, member 8
Gene Name: XKR8
Alternative Gene Name: FLJ10307
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037752: 51%, ENSRNOG00000024312: 53%
Entrez Gene ID: 55113
Uniprot ID: Q9H6D3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HPSCCWKPDPDQVDGARSLLSPEGYQLPQNRRMTHLAQKFFPKAKDEAASPVKG
• Gene Sequence: HPSCCWKPDPDQVDGARSLLSPEGYQLPQNRRMTHLAQKFFPKAKDEAASPVKG
• Gene ID - Mouse: ENSMUSG00000037752
• Gene ID - Rat: ENSRNOG00000024312
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.