Protein Description: XK related 6
Gene Name: XKR6
Alternative Gene Name: C8orf21, C8orf5, C8orf7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035067: 100%, ENSRNOG00000011634: 100%
Entrez Gene ID: 286046
Uniprot ID: Q5GH73
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: XKR6
Alternative Gene Name: C8orf21, C8orf5, C8orf7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035067: 100%, ENSRNOG00000011634: 100%
Entrez Gene ID: 286046
Uniprot ID: Q5GH73
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | FVDRRLRRTINILQYVTPTAVGIRYRDGPLLYELLQYESSL |
| Documents & Links for Anti XKR6 pAb (ATL-HPA064769) | |
| Datasheet | Anti XKR6 pAb (ATL-HPA064769) Datasheet (External Link) |
| Vendor Page | Anti XKR6 pAb (ATL-HPA064769) at Atlas |
| Documents & Links for Anti XKR6 pAb (ATL-HPA064769) | |
| Datasheet | Anti XKR6 pAb (ATL-HPA064769) Datasheet (External Link) |
| Vendor Page | Anti XKR6 pAb (ATL-HPA064769) |