Anti XKR6 pAb (ATL-HPA064769)

Atlas Antibodies

SKU: ATL-HPA064769-25

• 
• 

Protein Description: XK related 6
Gene Name: XKR6
Alternative Gene Name: C8orf21, C8orf5, C8orf7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035067: 100%, ENSRNOG00000011634: 100%
Entrez Gene ID: 286046
Uniprot ID: Q5GH73
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FVDRRLRRTINILQYVTPTAVGIRYRDGPLLYELLQYESSL
• Gene Sequence: FVDRRLRRTINILQYVTPTAVGIRYRDGPLLYELLQYESSL
• Gene ID - Mouse: ENSMUSG00000035067
• Gene ID - Rat: ENSRNOG00000011634
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.