Anti WNT11 pAb (ATL-HPA050101)

Atlas Antibodies

SKU: ATL-HPA050101-25

• 

Protein Description: wingless-type MMTV integration site family, member 11
Gene Name: WNT11
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015957: 94%, ENSRNOG00000015982: 95%
Entrez Gene ID: 7481
Uniprot ID: O96014
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SKTPSALALNQTQHCKQLEGLVSAQVQLCRSNLELMHTVVHAAREVMKACRRAFADMRWNCSSIELAPNYLLDLERGTRE
• Gene Sequence: SKTPSALALNQTQHCKQLEGLVSAQVQLCRSNLELMHTVVHAAREVMKACRRAFADMRWNCSSIELAPNYLLDLERGTRE
• Gene ID - Mouse: ENSMUSG00000015957
• Gene ID - Rat: ENSRNOG00000015982
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.