Protein Description: wingless-type MMTV integration site family, member 10B
Gene Name: WNT10B
Alternative Gene Name: SHFM6, WNT-12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022996: 97%, ENSRNOG00000061238: 97%
Entrez Gene ID: 7480
Uniprot ID: O00744
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: WNT10B
Alternative Gene Name: SHFM6, WNT-12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022996: 97%, ENSRNOG00000061238: 97%
Entrez Gene ID: 7480
Uniprot ID: O00744
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | SCQFKTCWRAAPEFRAVGAALRERLGRAIFIDTHNRNSGAFQPRLRPRRLSGELVYFEKS |
| Documents & Links for Anti WNT10B pAb (ATL-HPA062539) | |
| Datasheet | Anti WNT10B pAb (ATL-HPA062539) Datasheet (External Link) |
| Vendor Page | Anti WNT10B pAb (ATL-HPA062539) at Atlas |
| Documents & Links for Anti WNT10B pAb (ATL-HPA062539) | |
| Datasheet | Anti WNT10B pAb (ATL-HPA062539) Datasheet (External Link) |
| Vendor Page | Anti WNT10B pAb (ATL-HPA062539) |