Anti WNT10B pAb (ATL-HPA055048 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA055048-25

• 
• 

Protein Description: wingless-type MMTV integration site family, member 10B
Gene Name: WNT10B
Alternative Gene Name: SHFM6, WNT-12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022996: 93%, ENSRNOG00000061238: 95%
Entrez Gene ID: 7480
Uniprot ID: O00744
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SLGKLVSCGCGWKGSGEQDRLRAKLLQLQALSRGKSFPHSLPSPGPGSSPSPGPQDTWEWGGCNHDMDFGEKFS
• Gene Sequence: SLGKLVSCGCGWKGSGEQDRLRAKLLQLQALSRGKSFPHSLPSPGPGSSPSPGPQDTWEWGGCNHDMDFGEKFS
• Gene ID - Mouse: ENSMUSG00000022996
• Gene ID - Rat: ENSRNOG00000061238
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.